SCOPe 2.05: Domain d1scua2: 1scu A:122-288

Lineage for d1scua2 (1scu A:122-288)

Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
contain additional N-terminal strand "0", antiparallel to strand 2
Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (5 species)
Species Escherichia coli [TaxId:562] [52213] (11 PDB entries)
Domain d1scua2: 1scu A:122-288 [31135]
Other proteins in same PDB: d1scua1, d1scub1, d1scub2, d1scud1, d1scue1, d1scue2
complexed with coa

Details for d1scua2

PDB Entry: 1scu (more details), 2.5 Å

PDB Description: the crystal structure of succinyl-coa synthetase from escherichia coli at 2.5 angstroms resolution

PDB Compounds: (A:) succinyl-coa synthetase, alpha subunit

SCOPe Domain Sequences for d1scua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scua2 c.23.4.1 (A:122-288) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
ncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktvlk

SCOPe Domain Coordinates for d1scua2:

Click to download the PDB-style file with coordinates for d1scua2.
(The format of our PDB-style files is described here.)

Timeline for d1scua2: