Lineage for d2scua2 (2scu A:122-286)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68133Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 68270Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 68271Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)
  6. 68272Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (2 species)
  7. 68273Species Escherichia coli [TaxId:562] [52213] (4 PDB entries)
  8. 68274Domain d2scua2: 2scu A:122-286 [31131]
    Other proteins in same PDB: d2scua1, d2scub1, d2scub2, d2scud1, d2scue1, d2scue2

Details for d2scua2

PDB Entry: 2scu (more details), 2.3 Å

PDB Description: A detailed description of the structure of Succinyl-COA synthetase from Escherichia coli

SCOP Domain Sequences for d2scua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2scua2 c.23.4.1 (A:122-286) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli}
ncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktv

SCOP Domain Coordinates for d2scua2:

Click to download the PDB-style file with coordinates for d2scua2.
(The format of our PDB-style files is described here.)

Timeline for d2scua2: