SCOPe 2.03: Domain d1fyxa_: 1fyx A:

Lineage for d1fyxa_ (1fyx A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (2 families)

5. Family c.23.2.1: Toll/Interleukin receptor TIR domain [52201] (3 proteins)
   automatically mapped to Pfam PF01582

6. Protein Toll-like receptor 2, TLR2 [52204] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52205] (3 PDB entries)

8. Domain d1fyxa_: 1fyx A: [31128]
   mutant

Details for d1fyxa_

PDB Entry: 1fyx, 2.8 Å

PDB Description: crystal structure of p681h mutant of tir domain of human tlr2

PDB Compounds: (A:) toll-like receptor 2

SCOPe Domain Sequences for d1fyxa_:

Sequence; same for both SEQRES and ATOM records:

>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]}
srnicydafvsyserdaywvenlmvqelenfnppfklclhkrdfihgkwiidniidsiek
shktvfvlsenfvksewckyeldfshfrlfdenndaailillepiekkaipqrfcklrki
mntktylewpmdeaqregfwvnlraaiks

Timeline for d1fyxa_:

• d1fyxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1fyxa_ appears in SCOPe 2.02
  
• d1fyxa_ appears in SCOPe 2.04
  
• d1fyxa_ appears in the current release, SCOPe 2.08