SCOP 1.73: Domain d1qo0e_: 1qo0 E:

Lineage for d1qo0e_ (1qo0 E:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (7 families)

5. Family c.23.1.3: Positive regulator of the amidase operon AmiR [52197] (1 protein)

6. Protein Positive regulator of the amidase operon AmiR [52198] (1 species)
   contains coiled coil and small all-alpha subdomains in the C-terminal extension

7. Species Pseudomonas aeruginosa [TaxId:287] [52199] (1 PDB entry)

8. Domain d1qo0e_: 1qo0 E: [31126]
   Other proteins in same PDB: d1qo0a_, d1qo0b_

Details for d1qo0e_

PDB Entry: 1qo0, 2.25 Å

PDB Description: amide receptor of the amidase operon of pseudomonas aeruginosa (amic) complexed with the negative regulator amir.

PDB Compounds: (E:) amir

SCOP Domain Sequences for d1qo0e_:

Sequence; same for both SEQRES and ATOM records:

>d1qo0e_ c.23.1.3 (E:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]}
sansllgslrelqvlvlnppgevsdalvlqlirigcsvrqcwpppeafdvpvdvvftsif
qnrhhdeiaallaagtprttlvalveyespavlsqiielechgvitqpldahrvlpvlvs
arriseemaklkqkteqlqdriagqarinqakvllmqrhgwdereahqhlsreamkrrep
ilkiaqellgneps

Timeline for d1qo0e_:

• d1qo0e_ first appeared (with stable ids) in SCOP 1.55
  
• d1qo0e_ appears in SCOP 1.71
  
• d1qo0e_ appears in SCOP 1.75
  
• d1qo0e_ appears in the current release, SCOPe 2.08