![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (5 families) ![]() |
![]() | Family c.23.1.3: Positive regulator of the amidase operon AmiR [52197] (1 protein) |
![]() | Protein Positive regulator of the amidase operon AmiR [52198] (1 species) contains coiled coil and small all-alpha subdomains in the C-terminal extension |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [52199] (1 PDB entry) |
![]() | Domain d1qo0d_: 1qo0 D: [31125] Other proteins in same PDB: d1qo0a_, d1qo0b_ |
PDB Entry: 1qo0 (more details), 2.25 Å
SCOP Domain Sequences for d1qo0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa} sansllgslrelqvlvlnppgevsdalvlqlirigcsvrqcwpppeafdvpvdvvftsif qnrhhdeiaallaagtprttlvalveyespavlsqiielechgvitqpldahrvlpvlvs arriseemaklkqkteqlqdriagqarinqakvllmqrhgwdereahqhlsreamkrrep ilkiaqell
Timeline for d1qo0d_: