![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (7 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (25 proteins) |
![]() | Protein Transcriptional regulatory protein FixJ, receiver domain [52182] (1 species) |
![]() | Species Rhizobium meliloti [TaxId:382] [52183] (4 PDB entries) |
![]() | Domain d1d5wc_: 1d5w C: [31101] phosphorylated form complexed with pas, so4; mutant |
PDB Entry: 1d5w (more details), 2.3 Å
SCOP Domain Sequences for d1d5wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5wc_ c.23.1.1 (C:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase hl
Timeline for d1d5wc_: