Lineage for d1d5wb_ (1d5w B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 21774Superfamily c.23.1: CheY-like [52172] (3 families) (S)
  5. 21775Family c.23.1.1: CheY-related [52173] (9 proteins)
  6. 21871Protein Transcriptional regulatory protein FixJ, receiver domain [52182] (1 species)
  7. 21872Species Rhizobium meliloti [TaxId:382] [52183] (4 PDB entries)
  8. 21878Domain d1d5wb_: 1d5w B: [31100]

Details for d1d5wb_

PDB Entry: 1d5w (more details), 2.3 Å

PDB Description: phosphorylated fixj receiver domain
PDB Compounds: (B:)

SCOP Domain Sequences for d1d5wb_:

Sequence, based on SEQRES records: (download)

>d1d5wb_ c.23.1.1 (B:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti}
mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtxlrmpdm
sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
hl

Sequence, based on observed residues (ATOM records): (download)

>d1d5wb_ c.23.1.1 (B:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti}
mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtlrmpdms
gvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaieraseh
l

SCOP Domain Coordinates for d1d5wb_:

Click to download the PDB-style file with coordinates for d1d5wb_.
(The format of our PDB-style files is described here.)

Timeline for d1d5wb_: