Lineage for d1dbwa_ (1dbw A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825506Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 825507Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 825753Protein Transcriptional regulatory protein FixJ, receiver domain [52182] (1 species)
  7. 825754Species Rhizobium meliloti [TaxId:382] [52183] (4 PDB entries)
  8. 825755Domain d1dbwa_: 1dbw A: [31095]

Details for d1dbwa_

PDB Entry: 1dbw (more details), 1.6 Å

PDB Description: crystal structure of fixj-n
PDB Compounds: (A:) transcriptional regulatory protein fixj

SCOP Domain Sequences for d1dbwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]}
mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
hlv

SCOP Domain Coordinates for d1dbwa_:

Click to download the PDB-style file with coordinates for d1dbwa_.
(The format of our PDB-style files is described here.)

Timeline for d1dbwa_: