SCOPe 2.08: Domain d5f1qa1: 5f1q A:29-535

Lineage for d5f1qa1 (5f1q A:29-535)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Yersinia pestis [TaxId:377628] [311500] (1 PDB entry)

8. Domain d5f1qa1: 5f1q A:29-535 [310529]
   Other proteins in same PDB: d5f1qa2
   automated match to d1dppa_
   complexed with cl, edo, gln, gol, peg

Details for d5f1qa1

PDB Entry: 5f1q, 1.96 Å

PDB Description: crystal structure of periplasmic dipeptide transport protein from yersinia pestis

PDB Compounds: (A:) Periplasmic dipeptide transport protein

SCOPe Domain Sequences for d5f1qa1:

Sequence; same for both SEQRES and ATOM records:

>d5f1qa1 c.94.1.1 (A:29-535) automated matches {Yersinia pestis [TaxId: 377628]}
ktlvycsegspegfnpqlftsgttydassvpiynrlvefkigtteiepslaerwevsedg
ktytfylrkgvkwqdnkdfkptrdfnaddviysfmrqkddknpyhkvsggsyeyfqgmgm
gdlitnvvkvddntvrfeltrpespfladlamdfasilsaeyadnmlkagtpekvdlnpi
gtgpfqlqqyqkdsrilykafpgfwgtkpkidrlvfsitpdasvryaklqknecqimpyp
npadiarmkedktinlmeqpglnvgylsfniekkpldnlkvrqaltmavnkdaiidavyq
gagqaaknlipptmwgynddvkdyaydpakakellkeaglpdgfsidlwampvqrpynpn
arrmaemiqsdwakigvkakivtyewgeylkrakdgehetvmmgwtgdngdpdnffatlf
scdaakqgsnyskwcykpfedliqparaeadhdkrvalykqaqvvmneqapaliiahstv
yepvrkevkgyvvdplgkhhfdnvsld

Timeline for d5f1qa1:

• d5f1qa1 first appeared in SCOPe 2.06
  
• d5f1qa1 appears in SCOPe 2.07