SCOP 1.75: Domain d1udra_: 1udr A:

Lineage for d1udra_ (1udr A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (7 families)

5. Family c.23.1.1: CheY-related [52173] (25 proteins)

6. Protein CheY protein [52174] (4 species)

7. Species Escherichia coli [TaxId:562] [52175] (33 PDB entries)
   Uniprot P06143

8. Domain d1udra_: 1udr A: [31041]

Details for d1udra_

PDB Entry: 1udr, 1.9 Å

PDB Description: chey mutant with lys 91 replaced by asp, lys 92 replaced by ala, ile 96 replaced by lys and ala 98 replaced by leu (stabilizing mutations in helix 4)

PDB Compounds: (A:) chey protein

SCOP Domain Sequences for d1udra_:

Sequence; same for both SEQRES and ATOM records:

>d1udra_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}
kelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnm
dglellktiradgamsalpvlmvtaeadaenikalaqagasgyvvkpftaatleeklnki
feklgm

Timeline for d1udra_:

• d1udra_ first appeared (with stable ids) in SCOP 1.55
  
• d1udra_ appears in SCOP 1.73
  
• d1udra_ appears in SCOPe 2.01
  
• d1udra_ appears in the current release, SCOPe 2.08