Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (7 families) |
Family c.23.1.1: CheY-related [52173] (25 proteins) |
Protein CheY protein [52174] (4 species) |
Species Escherichia coli [TaxId:562] [52175] (33 PDB entries) Uniprot P06143 |
Domain d1udra_: 1udr A: [31041] |
PDB Entry: 1udr (more details), 1.9 Å
SCOP Domain Sequences for d1udra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udra_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]} kelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnm dglellktiradgamsalpvlmvtaeadaenikalaqagasgyvvkpftaatleeklnki feklgm
Timeline for d1udra_: