Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (11 families) |
Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
Protein Menin C-terminal domain [310725] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [310974] (33 PDB entries) |
Domain d5ddea2: 5dde A:231-459 [310407] Other proteins in same PDB: d5ddea1, d5ddea3 automated match to d3u85a2 complexed with 5a0, dms, edo, pg4, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 5dde (more details), 1.78 Å
SCOPe Domain Sequences for d5ddea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ddea2 a.118.8.1 (A:231-459) Menin C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd ynycredeeiykeffevandvipnllkeaaslleagsqgsalqdpecfahllrfydgick weegsptpvlhvgwatflvqslgrfegqvrqkvrivs
Timeline for d5ddea2: