SCOPe 2.06: Domain d5d57b_: 5d57 B:

Lineage for d5d57b_ (5d57 B:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.62: Diacylglycerol kinase (DgkA)-like [310569] (1 superfamily)
   forms homotrimer; each monomer has 3 transmembrane helices and one amphiphilic helix

4. Superfamily f.62.1: Diacylglycerol kinase (DgkA)-like [310600] (1 family)
   Pfam PF01219

5. Family f.62.1.1: Diacylglycerol kinase (DgkA)-like [310650] (2 proteins)

6. Protein Diacylglycerol kinase (DgkA) [310803] (1 species)

7. Species Escherichia coli K-12 [TaxId:83333] [311068] (11 PDB entries)

8. Domain d5d57b_: 5d57 B: [310371]
   automated match to d3ze3a_
   complexed with 78m

Details for d5d57b_

PDB Entry: 5d57, 2.8 Å

PDB Description: in meso x-ray crystallography structure of diacylglycerol kinase, dgka, at 100 k

PDB Compounds: (B:) Diacylglycerol kinase

SCOPe Domain Sequences for d5d57b_:

Sequence; same for both SEQRES and ATOM records:

>d5d57b_ f.62.1.1 (B:) Diacylglycerol kinase (DgkA) {Escherichia coli K-12 [TaxId: 83333]}
aawineaafrqegvavllcvviaawldvdavtrvllissvmlvmivellnsaieavvdri
gseyhelsgrakdlgsaavliaiidavitwaillwshfg

Timeline for d5d57b_:

• d5d57b_ is new in SCOPe 2.06-stable
  
• d5d57b_ appears in SCOPe 2.07
  
• d5d57b_ appears in the current release, SCOPe 2.08