Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Bacillus pumilus [TaxId:1408] [279437] (2 PDB entries) |
Domain d5ctna_: 5ctn A: [310355] automated match to d5ctma_ complexed with 5r7, flc |
PDB Entry: 5ctn (more details), 1.35 Å
SCOPe Domain Sequences for d5ctna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ctna_ e.3.1.0 (A:) automated matches {Bacillus pumilus [TaxId: 1408]} siawsvdeffknregtfviqevkekspwvynkkrakerfapqstfkvanaliglqtgavr deydikywdgvkreidnwnrdhtlgsgmrdsvvwyyqamardigeermnhwvkaihygnk disggidqfwlsstlrispieqvrflkqlyeetlpfdlknmrtvkrmmvqeeekhatlyg ktgsgsdigwyvgfikhehktyilatnikgtgieakdityrilkkyhlmeasv
Timeline for d5ctna_: