Lineage for d5ctna_ (5ctn A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014309Species Bacillus pumilus [TaxId:1408] [279437] (2 PDB entries)
  8. 3014312Domain d5ctna_: 5ctn A: [310355]
    automated match to d5ctma_
    complexed with 5r7, flc

Details for d5ctna_

PDB Entry: 5ctn (more details), 1.35 Å

PDB Description: structure of bpu1 beta-lactamase
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5ctna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ctna_ e.3.1.0 (A:) automated matches {Bacillus pumilus [TaxId: 1408]}
siawsvdeffknregtfviqevkekspwvynkkrakerfapqstfkvanaliglqtgavr
deydikywdgvkreidnwnrdhtlgsgmrdsvvwyyqamardigeermnhwvkaihygnk
disggidqfwlsstlrispieqvrflkqlyeetlpfdlknmrtvkrmmvqeeekhatlyg
ktgsgsdigwyvgfikhehktyilatnikgtgieakdityrilkkyhlmeasv

SCOPe Domain Coordinates for d5ctna_:

Click to download the PDB-style file with coordinates for d5ctna_.
(The format of our PDB-style files is described here.)

Timeline for d5ctna_: