Lineage for d1g7ra3 (1g7r A:329-459)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586431Fold c.20: Initiation factor IF2/eIF5b, domain 3 [52155] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1586432Superfamily c.20.1: Initiation factor IF2/eIF5b, domain 3 [52156] (1 family) (S)
    automatically mapped to Pfam PF11987
  5. 1586433Family c.20.1.1: Initiation factor IF2/eIF5b, domain 3 [52157] (1 protein)
  6. 1586434Protein Initiation factor IF2/eIF5b, domain 3 [52158] (1 species)
  7. 1586435Species Methanobacterium thermoautotrophicum [TaxId:145262] [52159] (3 PDB entries)
  8. 1586438Domain d1g7ra3: 1g7r A:329-459 [31034]
    Other proteins in same PDB: d1g7ra1, d1g7ra2, d1g7ra4

Details for d1g7ra3

PDB Entry: 1g7r (more details), 2.2 Å

PDB Description: x-ray structure of translation initiation factor if2/eif5b
PDB Compounds: (A:) translation initiation factor if2/eif5b

SCOPe Domain Sequences for d1g7ra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7ra3 c.20.1.1 (A:329-459) Initiation factor IF2/eIF5b, domain 3 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
dpekvreeilseiedikidtdeagvvvkadtlgsleavvkilrdmyvpikvadigdvsrr
dvvnagialqedrvygaiiafnvkvipsaaqelknsdiklfqgnviyrlmeeyeewvrgi
eeekkkkwmea

SCOPe Domain Coordinates for d1g7ra3:

Click to download the PDB-style file with coordinates for d1g7ra3.
(The format of our PDB-style files is described here.)

Timeline for d1g7ra3: