Lineage for d5c6na_ (5c6n A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2581148Fold f.61: Multidrug and toxic compound extrusion (MATE) transporter-like [310559] (1 superfamily)
  4. 2581149Superfamily f.61.1: Multidrug and toxic compound extrusion (MATE) transporters [310586] (1 family) (S)
    Pfam PF01554; Pfam PF14667
  5. 2581150Family f.61.1.1: Multidrug and toxic compound extrusion (MATE) transporters [310633] (2 proteins)
  6. 2581151Protein DinF [310763] (1 species)
  7. 2581152Species Bacillus halodurans [TaxId:272558] [311018] (3 PDB entries)
  8. 2581153Domain d5c6na_: 5c6n A: [310332]
    automated match to d4lz6a_

Details for d5c6na_

PDB Entry: 5c6n (more details), 3 Å

PDB Description: protein a
PDB Compounds: (A:) BH2163 protein

SCOPe Domain Sequences for d5c6na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c6na_ f.61.1.1 (A:) DinF {Bacillus halodurans [TaxId: 272558]}
qkqqserlgteaipkllrslsipamigmfvmalynvvntifisyavgiegvagvtiafpi
mmimmsmagalgiggasvisrrlgerrgeeanqvfgniltvilvlsvigfisaftllgpa
lqlfgatsvtqgyatdylfpillgsiffffafaanniirsegnatfamvtmivpavlnil
ldvlfifglnmgvlgasiatviaqasvtglvlryfltgkstlslhwsdlrmkgsvikevc
lvglpafvqqssaslmmiainsmllrfgsdfyvgvfglvqrimmfvmmpmmgimqamqpi
vgynygakqysrlretvmlgfkvatifsigifallmlfpeallrvftadreviqagvsam
hilfcvtfligaqivagglyqslgkpkqalilslsrqiifliplvlilphifglsgvwwa
fpiadvlsfiltvvllyrdrnvfflk

SCOPe Domain Coordinates for d5c6na_:

Click to download the PDB-style file with coordinates for d5c6na_.
(The format of our PDB-style files is described here.)

Timeline for d5c6na_: