SCOPe 2.08: Domain d5bv8a1: 5bv8 A:1261-1461

Lineage for d5bv8a1 (5bv8 A:1261-1461)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)

6. Protein von Willebrand factor A1 domain, vWA1 [53306] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53307] (11 PDB entries)

8. Domain d5bv8a1: 5bv8 A:1261-1461 [310315]
   Other proteins in same PDB: d5bv8a2
   automated match to d1auqa_
   complexed with cl, edo; mutant

Details for d5bv8a1

PDB Entry: 5bv8, 1.59 Å

PDB Description: g1324s mutation in von willebrand factor a1 domain

PDB Compounds: (A:) von willebrand factor

SCOPe Domain Sequences for d5bv8a1:

Sequence; same for both SEQRES and ATOM records:

>d5bv8a1 c.62.1.1 (A:1261-1461) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}
disepplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavve
yhdsshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasri
alllmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvl
ssvdeleqqrdeivsylcdla

Timeline for d5bv8a1:

• d5bv8a1 first appeared in SCOPe 2.06
  
• d5bv8a1 appears in SCOPe 2.07