Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
Protein Enolase [51606] (11 species) Fold of this protein slightly differs from common fold in topology |
Species Staphylococcus aureus [TaxId:1280] [311489] (2 PDB entries) |
Domain d5bofb2: 5bof B:140-434 [310307] Other proteins in same PDB: d5bofa1, d5bofb1 automated match to d1w6ta1 complexed with mg, so4 |
PDB Entry: 5bof (more details), 2.45 Å
SCOPe Domain Sequences for d5bofb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bofb2 c.1.11.1 (B:140-434) Enolase {Staphylococcus aureus [TaxId: 1280]} ngkqlpvpmmnivnggshsdapiafqefmilpvgattfkeslrwgteifhnlksilskrg letavgdeggfapkfegtedavetiiqaieaagykpgeevflgfdcassefyengvydys kfegehgakrtaaeqvdyleqlvdkypiitiedgmdendwdgwkqlterigdrvqlvgdd lfvtnteilakgiengignsilikvnqigtltetfdaiemaqkagytavvshrsgetedt tiadiavatnagqiktgslsrtdriakynqllriedelfetakydgiksfynldk
Timeline for d5bofb2: