Lineage for d5bofa2 (5bof A:140-434)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2098969Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2098970Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 2098971Protein Enolase [51606] (10 species)
    Fold of this protein slightly differs from common fold in topology
  7. 2099058Species Staphylococcus aureus [TaxId:1280] [311489] (2 PDB entries)
  8. 2099061Domain d5bofa2: 5bof A:140-434 [310305]
    Other proteins in same PDB: d5bofa1, d5bofb1
    automated match to d1w6ta1
    complexed with mg, so4

Details for d5bofa2

PDB Entry: 5bof (more details), 2.45 Å

PDB Description: crystal structure of staphylococcus aureus enolase
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d5bofa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bofa2 c.1.11.1 (A:140-434) Enolase {Staphylococcus aureus [TaxId: 1280]}
ngkqlpvpmmnivnggshsdapiafqefmilpvgattfkeslrwgteifhnlksilskrg
letavgdeggfapkfegtedavetiiqaieaagykpgeevflgfdcassefyengvydys
kfegehgakrtaaeqvdyleqlvdkypiitiedgmdendwdgwkqlterigdrvqlvgdd
lfvtnteilakgiengignsilikvnqigtltetfdaiemaqkagytavvshrsgetedt
tiadiavatnagqiktgslsrtdriakynqllriedelfetakydgiksfynldk

SCOPe Domain Coordinates for d5bofa2:

Click to download the PDB-style file with coordinates for d5bofa2.
(The format of our PDB-style files is described here.)

Timeline for d5bofa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5bofa1