![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
![]() | Protein Enolase [51606] (10 species) Fold of this protein slightly differs from common fold in topology |
![]() | Species Staphylococcus aureus [TaxId:1280] [311489] (2 PDB entries) |
![]() | Domain d5boeb2: 5boe B:140-433 [310303] Other proteins in same PDB: d5boea1, d5boeb1 automated match to d1w6ta1 complexed with gol, mg, pep |
PDB Entry: 5boe (more details), 1.6 Å
SCOPe Domain Sequences for d5boeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5boeb2 c.1.11.1 (B:140-433) Enolase {Staphylococcus aureus [TaxId: 1280]} ngkqlpvpmmnivnggshsdapiafqefmilpvgattfkeslrwgteifhnlksilskrg letavgdeggfapkfegtedavetiiqaieaagykpgeevflgfdcassefyengvydys kfegehgakrtaaeqvdyleqlvdkypiitiedgmdendwdgwkqlterigdrvqlvgdd lfvtnteilakgiengignsilikvnqigtltetfdaiemaqkagytavvshrsgetedt tiadiavatnagqiktgslsrtdriakynqllriedelfetakydgiksfynld
Timeline for d5boeb2: