SCOPe 2.07: Domain d5boeb2: 5boe B:140-433

Lineage for d5boeb2 (5boe B:140-433)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.1: Enolase [51605] (2 proteins)
   automatically mapped to Pfam PF00113

6. Protein Enolase [51606] (10 species)
   Fold of this protein slightly differs from common fold in topology

7. Species Staphylococcus aureus [TaxId:1280] [311489] (2 PDB entries)

8. Domain d5boeb2: 5boe B:140-433 [310303]
   Other proteins in same PDB: d5boea1, d5boeb1
   automated match to d1w6ta1
   complexed with gol, mg, pep

Details for d5boeb2

PDB Entry: 5boe, 1.6 Å

PDB Description: crystal structure of staphylococcus aureus enolase in complex with pep

PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d5boeb2:

Sequence; same for both SEQRES and ATOM records:

>d5boeb2 c.1.11.1 (B:140-433) Enolase {Staphylococcus aureus [TaxId: 1280]}
ngkqlpvpmmnivnggshsdapiafqefmilpvgattfkeslrwgteifhnlksilskrg
letavgdeggfapkfegtedavetiiqaieaagykpgeevflgfdcassefyengvydys
kfegehgakrtaaeqvdyleqlvdkypiitiedgmdendwdgwkqlterigdrvqlvgdd
lfvtnteilakgiengignsilikvnqigtltetfdaiemaqkagytavvshrsgetedt
tiadiavatnagqiktgslsrtdriakynqllriedelfetakydgiksfynld

Timeline for d5boeb2:

• d5boeb2 first appeared in SCOPe 2.06
  
• d5boeb2 appears in the current release, SCOPe 2.08