SCOPe 2.02: Domain d1uuga_: 1uug A:

Lineage for d1uuga_ (1uug A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein Uracil-DNA glycosylase [52143] (5 species)

7. Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)

8. Domain d1uuga_: 1uug A: [31023]
   Other proteins in same PDB: d1uugb_, d1uugd_
   protein/DNA complex

Details for d1uuga_

PDB Entry: 1uug, 2.4 Å

PDB Description: escherichia coli uracil-dna glycosylase:inhibitor complex with wild-type udg and wild-type ugi

PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d1uuga_:

Sequence; same for both SEQRES and ATOM records:

>d1uuga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
aphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa

Timeline for d1uuga_:

• d1uuga_ first appeared (with stable ids) in SCOP 1.55
  
• d1uuga_ appears in SCOPe 2.01
  
• d1uuga_ appears in SCOPe 2.03
  
• d1uuga_ appears in the current release, SCOPe 2.08