Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) |
Family d.139.1.0: automated matches [227182] (1 protein) not a true family |
Protein automated matches [226902] (12 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [311487] (1 PDB entry) |
Domain d5avma1: 5avm A:167-333 [310199] Other proteins in same PDB: d5avma2, d5avmb2, d5avmc2, d5avmd2, d5avme2, d5avmf2, d5avmg2, d5avmh2 automated match to d3m84a2 complexed with so4 |
PDB Entry: 5avm (more details), 2.2 Å
SCOPe Domain Sequences for d5avma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5avma1 d.139.1.0 (A:167-333) automated matches {Thermus thermophilus [TaxId: 300852]} gpervregdallalpssgphtngyslirkvvagqdlsapvpelgeslkeallrphraylk efrllweagvelhaaahitggglpenlpralppglgaevrrgswpippvfpylqrlggip eeemyrvfnmglgmvlvlpqeaaeealklvegflvgrvvpgegvrlv
Timeline for d5avma1: