Lineage for d5avma1 (5avm A:167-333)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978140Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2978141Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2978221Family d.139.1.0: automated matches [227182] (1 protein)
    not a true family
  6. 2978222Protein automated matches [226902] (12 species)
    not a true protein
  7. 2978256Species Thermus thermophilus [TaxId:300852] [311487] (1 PDB entry)
  8. 2978257Domain d5avma1: 5avm A:167-333 [310199]
    Other proteins in same PDB: d5avma2, d5avmb2, d5avmc2, d5avmd2, d5avme2, d5avmf2, d5avmg2, d5avmh2
    automated match to d3m84a2
    complexed with so4

Details for d5avma1

PDB Entry: 5avm (more details), 2.2 Å

PDB Description: crystal structures of 5-aminoimidazole ribonucleotide (air) synthetase, purm, from thermus thermophilus
PDB Compounds: (A:) phosphoribosylformylglycinamidine cyclo-ligase

SCOPe Domain Sequences for d5avma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5avma1 d.139.1.0 (A:167-333) automated matches {Thermus thermophilus [TaxId: 300852]}
gpervregdallalpssgphtngyslirkvvagqdlsapvpelgeslkeallrphraylk
efrllweagvelhaaahitggglpenlpralppglgaevrrgswpippvfpylqrlggip
eeemyrvfnmglgmvlvlpqeaaeealklvegflvgrvvpgegvrlv

SCOPe Domain Coordinates for d5avma1:

Click to download the PDB-style file with coordinates for d5avma1.
(The format of our PDB-style files is described here.)

Timeline for d5avma1: