Lineage for d5ahjt_ (5ahj T:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228415Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2228609Domain d5ahjt_: 5ahj T: [310180]
    Other proteins in same PDB: d5ahja_, d5ahjc_, d5ahje_, d5ahjg_, d5ahji_, d5ahjj_, d5ahjk_, d5ahjl_, d5ahjm_, d5ahjn_, d5ahjo_, d5ahjq_, d5ahjs_, d5ahju_, d5ahjw_, d5ahjx_, d5ahjy_, d5ahjz_
    automated match to d4g4sg_
    complexed with 7im, cl, mes, mg

Details for d5ahjt_

PDB Entry: 5ahj (more details), 2.8 Å

PDB Description: yeast 20s proteasome in complex with macyranone a
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5ahjt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ahjt_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
eing

SCOPe Domain Coordinates for d5ahjt_:

Click to download the PDB-style file with coordinates for d5ahjt_.
(The format of our PDB-style files is described here.)

Timeline for d5ahjt_: