Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries) |
Domain d5ahjt_: 5ahj T: [310180] Other proteins in same PDB: d5ahja_, d5ahjc1, d5ahjc2, d5ahjd_, d5ahje_, d5ahjg_, d5ahji_, d5ahjj_, d5ahjk_, d5ahjl_, d5ahjm_, d5ahjn_, d5ahjo_, d5ahjq1, d5ahjq2, d5ahjr_, d5ahjs_, d5ahju_, d5ahjw_, d5ahjx_, d5ahjy_, d5ahjz_ automated match to d4g4sg_ complexed with 7im, cl, mes, mg |
PDB Entry: 5ahj (more details), 2.8 Å
SCOPe Domain Sequences for d5ahjt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ahjt_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk eing
Timeline for d5ahjt_:
View in 3D Domains from other chains: (mouse over for more information) d5ahja_, d5ahjb_, d5ahjc1, d5ahjc2, d5ahjd_, d5ahje_, d5ahjf_, d5ahjg_, d5ahjh_, d5ahji_, d5ahjj_, d5ahjk_, d5ahjl_, d5ahjm_, d5ahjn_, d5ahjo_, d5ahjp_, d5ahjq1, d5ahjq2, d5ahjr_, d5ahjs_, d5ahju_, d5ahjv_, d5ahjw_, d5ahjx_, d5ahjy_, d5ahjz_ |