Lineage for d5ahjp_ (5ahj P:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993333Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2993564Domain d5ahjp_: 5ahj P: [310177]
    Other proteins in same PDB: d5ahja_, d5ahjc1, d5ahjc2, d5ahjd_, d5ahje_, d5ahjg_, d5ahji_, d5ahjj_, d5ahjk_, d5ahjl_, d5ahjm_, d5ahjn_, d5ahjo_, d5ahjq1, d5ahjq2, d5ahjr_, d5ahjs_, d5ahju_, d5ahjw_, d5ahjx_, d5ahjy_, d5ahjz_
    automated match to d1rypc_
    complexed with 7im, cl, mes, mg

Details for d5ahjp_

PDB Entry: 5ahj (more details), 2.8 Å

PDB Description: yeast 20s proteasome in complex with macyranone a
PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d5ahjp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ahjp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d5ahjp_:

Click to download the PDB-style file with coordinates for d5ahjp_.
(The format of our PDB-style files is described here.)

Timeline for d5ahjp_: