Lineage for d5ahjm_ (5ahj M:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2550690Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2550699Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (199 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2552258Domain d5ahjm_: 5ahj M: [310174]
    Other proteins in same PDB: d5ahjb_, d5ahjc_, d5ahjd_, d5ahje_, d5ahjf_, d5ahjg_, d5ahjh_, d5ahjp_, d5ahjq_, d5ahjr_, d5ahjs_, d5ahjt_, d5ahju_, d5ahjv_
    automated match to d1rypn_
    complexed with 7im, cl, mes, mg

Details for d5ahjm_

PDB Entry: 5ahj (more details), 2.8 Å

PDB Description: yeast 20s proteasome in complex with macyranone a
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d5ahjm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ahjm_ d.153.1.4 (M:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d5ahjm_:

Click to download the PDB-style file with coordinates for d5ahjm_.
(The format of our PDB-style files is described here.)

Timeline for d5ahjm_: