Lineage for d1udie_ (1udi E:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.18: DNA glycosylase [52140] (1 superfamily) Superfamily c.18.1: DNA glycosylase [52141] (2 families) 
Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein) Protein Uracil-DNA glycosylase [52143] (3 species) 
Species Herpes simplex virus type 1 [TaxId:10298] [52145] (4 PDB entries) 
Domain d1udie_: 1udi E: [31017]
Other proteins in same PDB: d1udii_
Details for d1udie_
PDB Entry: 1udi (more details), 2.7 Å
PDB Description: nucleotide mimicry in the crystal structure of the uracil-dna glycosylase-uracil glycosylase inhibitor protein complex
SCOP Domain Sequences for d1udie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udie_ c.18.1.1 (E:) Uracil-DNA glycosylase {Herpes simplex virus type 1}
dwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryctp
devrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgclek
wardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnair
pdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv
SCOP Domain Coordinates for d1udie_:
Click to download the PDB-style file with coordinates for d1udie_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1udie_:
- d1udie_ appears in SCOP 1.57
- d1udie_ appears in the current release, SCOPe 2.08
View in 3D
