Lineage for d5acqa_ (5acq A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997604Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2997605Protein automated matches [190418] (31 species)
    not a true protein
  7. 2997930Species Pseudomonas aeruginosa [TaxId:287] [187706] (20 PDB entries)
  8. 2997949Domain d5acqa_: 5acq A: [310148]
    automated match to d4f6ha_
    complexed with zn

Details for d5acqa_

PDB Entry: 5acq (more details), 1.7 Å

PDB Description: w228a-investigation of the impact from residues w228 and y233 in the metallo-beta-lactamase gim-1
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5acqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5acqa_ d.157.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
hkplevikiedgvylhtsfkniegyglvdsnglvvldnnqayiidtpwseedtklllswa
tdrgyqvmasisthshedrtagikllnsksiptytseltkkllaregkpvpthyfkddef
tlgnglielyypgaghtednivawlpkskilfggclvrsheaeglgyvgdasisswadsi
knivskkypiqmvvpghgkvgssdildhtidlaesasn

SCOPe Domain Coordinates for d5acqa_:

Click to download the PDB-style file with coordinates for d5acqa_.
(The format of our PDB-style files is described here.)

Timeline for d5acqa_: