Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.0: automated matches [191460] (1 protein) not a true family |
Protein automated matches [190710] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries) |
Domain d5a6rc_: 5a6r C: [310139] automated match to d5bxbc_ |
PDB Entry: 5a6r (more details), 2.85 Å
SCOPe Domain Sequences for d5a6rc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a6rc_ d.42.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} wgkwvrlnvggtvflttrqtlcreqksflsrlcqgeelqsdrdetgaylidrdptyfgpi lnflrhgklvldkdmaeegvleeaefynigpliriikdrmee
Timeline for d5a6rc_:
View in 3D Domains from other chains: (mouse over for more information) d5a6ra_, d5a6rb_, d5a6rd_, d5a6re_ |