Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (77 species) not a true protein |
Species Actinobacillus succinogenes [TaxId:339671] [188337] (2 PDB entries) |
Domain d4ywhb_: 4ywh B: [310115] Other proteins in same PDB: d4ywha2 automated match to d4ry9a_ complexed with xyp |
PDB Entry: 4ywh (more details), 2.35 Å
SCOPe Domain Sequences for d4ywhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ywhb_ c.93.1.0 (B:) automated matches {Actinobacillus succinogenes [TaxId: 339671]} dltigmsiddlrlerwqkdrdifvkkaeslgakvlvqsangddsaqisqienmlnknvdv lviiphngdvlsnviseakkegvkvlaydrlinnadldfyvsfdnekvgelqadaiikek pegnyflmggspvdnnaklfrkgqmkvlqplidsgkikvvgdqwvdswlaekalqimena ltanknnidavvasndataggaiqalsaqglsgkvaisgqdadlaaikrivegtqtmtvy kpitnladkaaelsvalgkeeklepnaklnnglkevdaylldpivvtkdnidstvikdgf hskeavy
Timeline for d4ywhb_: