Lineage for d4ywhb_ (4ywh B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913231Species Actinobacillus succinogenes [TaxId:339671] [188337] (2 PDB entries)
  8. 2913235Domain d4ywhb_: 4ywh B: [310115]
    Other proteins in same PDB: d4ywha2
    automated match to d4ry9a_
    complexed with xyp

Details for d4ywhb_

PDB Entry: 4ywh (more details), 2.35 Å

PDB Description: crystal structure of an abc transporter solute binding protein (ipr025997) from actinobacillus succinogenes 130z (asuc_0499, target efi-511068) with bound d-xylose
PDB Compounds: (B:) abc transporter solute binding protein

SCOPe Domain Sequences for d4ywhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ywhb_ c.93.1.0 (B:) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
dltigmsiddlrlerwqkdrdifvkkaeslgakvlvqsangddsaqisqienmlnknvdv
lviiphngdvlsnviseakkegvkvlaydrlinnadldfyvsfdnekvgelqadaiikek
pegnyflmggspvdnnaklfrkgqmkvlqplidsgkikvvgdqwvdswlaekalqimena
ltanknnidavvasndataggaiqalsaqglsgkvaisgqdadlaaikrivegtqtmtvy
kpitnladkaaelsvalgkeeklepnaklnnglkevdaylldpivvtkdnidstvikdgf
hskeavy

SCOPe Domain Coordinates for d4ywhb_:

Click to download the PDB-style file with coordinates for d4ywhb_.
(The format of our PDB-style files is described here.)

Timeline for d4ywhb_: