Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) |
Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins) |
Protein Uracil-DNA glycosylase [52143] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [52144] (14 PDB entries) |
Domain d1sspe_: 1ssp E: [31009] protein/DNA complex; complexed with ura |
PDB Entry: 1ssp (more details), 1.9 Å
SCOPe Domain Sequences for d1sspe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sspe_ c.18.1.1 (E:) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel
Timeline for d1sspe_: