SCOPe 2.02: Domain d1sspe_: 1ssp E:

Lineage for d1sspe_ (1ssp E:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein Uracil-DNA glycosylase [52143] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52144] (14 PDB entries)

8. Domain d1sspe_: 1ssp E: [31009]
   protein/DNA complex; complexed with ura

Details for d1sspe_

PDB Entry: 1ssp, 1.9 Å

PDB Description: wild-type uracil-dna glycosylase bound to uracil-containing dna

PDB Compounds: (E:) uracil-DNA glycosylase

SCOPe Domain Sequences for d1sspe_:

Sequence; same for both SEQRES and ATOM records:

>d1sspe_ c.18.1.1 (E:) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

Timeline for d1sspe_:

• d1sspe_ first appeared (with stable ids) in SCOP 1.55
  
• d1sspe_ appears in SCOPe 2.01
  
• d1sspe_ appears in SCOPe 2.03
  
• d1sspe_ appears in the current release, SCOPe 2.08, called d1sspe1