Lineage for d1akza1 (1akz A:85-304)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463295Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2463296Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2463297Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 2463298Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 2463341Species Human (Homo sapiens) [TaxId:9606] [52144] (16 PDB entries)
  8. 2463344Domain d1akza1: 1akz A:85-304 [31007]
    Other proteins in same PDB: d1akza2

Details for d1akza1

PDB Entry: 1akz (more details), 1.57 Å

PDB Description: human uracil-dna glycosylase
PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d1akza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akza1 c.18.1.1 (A:85-304) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
fgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvilgq
dpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvllln
avltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrhhvl
qtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

SCOPe Domain Coordinates for d1akza1:

Click to download the PDB-style file with coordinates for d1akza1.
(The format of our PDB-style files is described here.)

Timeline for d1akza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1akza2