Lineage for d1cvra2 (1cvr A:1-350)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21684Fold c.17: Caspase-like [52128] (1 superfamily)
  4. 21685Superfamily c.17.1: Caspase-like [52129] (2 families) (S)
  5. 21707Family c.17.1.2: Gingipain R (RgpB), N-terminal domain [52137] (1 protein)
  6. 21708Protein Gingipain R (RgpB), N-terminal domain [52138] (1 species)
  7. 21709Species Porphyromonas gingivalis [TaxId:837] [52139] (1 PDB entry)
  8. 21710Domain d1cvra2: 1cvr A:1-350 [31006]
    Other proteins in same PDB: d1cvra1

Details for d1cvra2

PDB Entry: 1cvr (more details), 2 Å

PDB Description: Crystal structure of the Arg specific cysteine proteinase gingipain R (RGPB)

SCOP Domain Sequences for d1cvra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvra2 c.17.1.2 (A:1-350) Gingipain R (RgpB), N-terminal domain {Porphyromonas gingivalis}
ytpveekengrmivivakkyegdikdfvdwknqrglrtevkvaediaspvtanaiqqfvk
qeyekegndltyvllvgdhkdipakitpgiksdqvygqivgndhynevfigrfscesked
lktqidrtihyernittedkwlgqalciasaeggpsadngesdiqhenvianlltqygyt
kiikcydpgvtpkniidafnggislvnytghgsetawgtshfgtthvkqltnsnqlpfif
dvacvngdflfsmpcfaealmraqkdgkptgtvaiiastidqywappmrgqdemneilce
khpnnikrtfggvtmngmfamvekykkdgenmldtwtvfgdpsllvrtlv

SCOP Domain Coordinates for d1cvra2:

Click to download the PDB-style file with coordinates for d1cvra2.
(The format of our PDB-style files is described here.)

Timeline for d1cvra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cvra1