SCOPe 2.06: Domain d1qdu.5: 1qdu I:,J:

Lineage for d1qdu.5 (1qdu I:,J:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.17: Caspase-like [52128] (1 superfamily)
   3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest

4. Superfamily c.17.1: Caspase-like [52129] (3 families)
   mature protein may be composed of two chains folded in a single domain

5. Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins)

6. Protein Caspase-8 [52135] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52136] (7 PDB entries)

8. Domain d1qdu.5: 1qdu I:,J: [31004]

Details for d1qdu.5

PDB Entry: 1qdu, 2.8 Å

PDB Description: crystal structure of the complex of caspase-8 with the tripeptide ketone inhibitor zevd-dcbmk

PDB Compounds: (I:) caspase-8 alpha-chain, (J:) caspase-8 beta-chain

SCOPe Domain Sequences for d1qdu.5:

Sequence; same for both SEQRES and ATOM records:

>g1qdu.5 c.17.1.1 (I:,J:) Caspase-8 {Human (Homo sapiens) [TaxId: 9606]}
ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei
kphhdctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft
glkcpslagkpkvffiqacqgdnyqkgipvetdXtryipdeadfllgmatvnncvsyrnp
aegtwyiqslcqslrercprgddiltiltevnyevsnkddkknmgkqmpqptftlrkklv
fp

Timeline for d1qdu.5:

• d1qdu.5 first appeared (with stable ids) in SCOP 1.55
  
• d1qdu.5 appears in SCOPe 2.05
  
• d1qdu.5 appears in SCOPe 2.07
  
• d1qdu.5 appears in the current release, SCOPe 2.08