![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.17: Caspase-like [52128] (1 superfamily) 3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest |
![]() | Superfamily c.17.1: Caspase-like [52129] (2 families) ![]() mature protein may be composed of two chains folded in a single domain |
![]() | Family c.17.1.1: Caspase catalytic domain [52130] (7 proteins) |
![]() | Protein Caspase-8 [52135] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52136] (5 PDB entries) |
![]() | Domain d1qtn.1: 1qtn A:,B: [30999] complexed with ace, dtd |
PDB Entry: 1qtn (more details), 1.2 Å
SCOP Domain Sequences for d1qtn.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1qtn.1 c.17.1.1 (A:,B:) Caspase-8 {Human (Homo sapiens) [TaxId: 9606]} dkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfeik phddctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqftg lkcpslagkpkvffiqacqgdnyqkgipvetdXtryipdeadfllgmatvnncvsyrnpa egtwyiqslcqslrercprgddiltiltevnyevsnkddkknmgkqmpqptftlrkklvf psd
Timeline for d1qtn.1: