SCOP 1.57: Domain d1bmq.1: 1bmq A:,B:

Lineage for d1bmq.1 (1bmq A:,B:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.17: Caspase-like [52128] (1 superfamily)

4. Superfamily c.17.1: Caspase-like [52129] (2 families)

5. Family c.17.1.1: Caspase [52130] (4 proteins)

6. Protein Interleukin-1beta converting enzyme (a cysteine protease) [52133] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52134] (3 PDB entries)

8. Domain d1bmq.1: 1bmq A:,B: [30998]

Details for d1bmq.1

PDB Entry: 1bmq, 2.5 Å

PDB Description: crystal structure of the complex of interleukin-1beta converting enzyme (ice) with a peptide based inhibitor, (3s )-n-methanesulfonyl-3-({1-[n-(2-naphtoyl)-l-valyl]-l-prolyl }amino)-4-oxobutanamide

SCOP Domain Sequences for d1bmq.1:

Sequence; same for both SEQRES and ATOM records:

>g1bmq.1 c.17.1.1 (A:,B:) Interleukin-1beta converting enzyme (a cysteine protease) {Human (Homo sapiens)}
gnvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprrtgaevditgmt
mllqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmshgiregicgkkhse
qvpdilqlnaifnmlntkncpslkdkpkviiiqacrgdspgvvwfkdXaikkahiekdfi
afcsstpdnvswrhptmgsvfigrliehmqeyacscdveeifrkvrfsfeqpdgraqmpt
tervtltrcfylfpgh

Timeline for d1bmq.1:

• d1bmq.1 first appeared (with stable ids) in SCOP 1.55
  
• d1bmq.1 appears in SCOP 1.59
  
• d1bmq.1 appears in the current release, SCOPe 2.08