Lineage for d1ice.1 (1ice A:,B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.17: Caspase-like [52128] (1 superfamily) Superfamily c.17.1: Caspase-like [52129] (2 families) 
Family c.17.1.1: Caspase [52130] (3 proteins) 
Protein Interleukin-1beta converting enzyme (a cysteine protease) [52133] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52134] (3 PDB entries) 
Domain d1ice.1: 1ice A:,B: [30996]
Details for d1ice.1
PDB Entry: 1ice (more details), 2.6 Å
PDB Description: structure and mechanism of interleukin-1beta converting enzyme
SCOP Domain Sequences for d1ice.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1ice.1 c.17.1.1 (A:,B:) Interleukin-1beta converting enzyme (a cysteine protease) {Human (Homo sapiens)}
gnvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprrtgaevditgmt
mllqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmshgiregicgkkhse
qvpdilqlnaifnmlntkncpslkdkpkviiiqacrgdspgvvwfkdXaikkahiekdfi
afcsstpdnvswrhptmgsvfigrliehmqeyacscdveeifrkvrfsfeqpdgraqmpt
tervtltrcfylfpgh
SCOP Domain Coordinates for d1ice.1:
Click to download the PDB-style file with coordinates for d1ice.1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ice.1:
- d1ice.1 appears in SCOP 1.57
- d1ice.1 appears in the current release, SCOPe 2.08
View in 3D