SCOPe 2.08: Domain d4x2vb1: 4x2v B:1-184

Lineage for d4x2vb1 (4x2v B:1-184)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species Murine norovirus 1 [TaxId:223997] [311357] (5 PDB entries)

8. Domain d4x2vb1: 4x2v B:1-184 [309947]
   Other proteins in same PDB: d4x2vb2
   automated match to d2fyqa_
   complexed with imd; mutant

Details for d4x2vb1

PDB Entry: 4x2v, 2.3 Å

PDB Description: crystal structure of the murine norovirus ns6 protease (inactive c139a mutant) with a c-terminal extension to include residue p1 prime of ns7

PDB Compounds: (B:) ns6 protease

SCOPe Domain Sequences for d4x2vb1:

Sequence; same for both SEQRES and ATOM records:

>d4x2vb1 b.47.1.4 (B:1-184) automated matches {Murine norovirus 1 [TaxId: 223997]}
apvsiwsrvvqfgtgwgfwvsghvfitakhvappkgteifgrkpgdftvtssgdflkyyf
tsavrpdipamvlengcqegvvasvlvkrasgemlalavrmgsqaaikigsavvhgqtgm
lltgsnakaqdlgtipgdagcpyvykkgntwvvigvhvaatrsgntviaathgeptleal
efqg

Timeline for d4x2vb1:

• d4x2vb1 first appeared in SCOPe 2.06
  
• d4x2vb1 appears in SCOPe 2.07