Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Caldicellulosiruptor sp. [TaxId:1214564] [311461] (2 PDB entries) |
Domain d4x0vc_: 4x0v C: [309940] automated match to d1edga_ |
PDB Entry: 4x0v (more details), 2.8 Å
SCOPe Domain Sequences for d4x0vc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x0vc_ c.1.8.0 (C:) automated matches {Caldicellulosiruptor sp. [TaxId: 1214564]} nrakipeikiasrkipnnaalkfvkdmkigwnlgntfdaafenpsfddellyetawcgvk ttkqmidtvkkagfntiripvswhnhvtgsnftiskrwldrvqqvvdyamknkmyviini hhdimpgyyypnsqhlqtsikyvksiwtqvatrfknyndhlifeavneprltgsrfewwl dmnnpecrdaveainklnqvfvdtvrstggnnvsrylmvpgyaaapeyvlidefkipkds skyknriiisvhayrpynfalqapnesgsvsewsvnseesrrdidyfmdklydkfvskgi pvvigefgardkngnlqsrvefaayyvraarargitccwwdnnafygngenfglldrktl kwvypeivsammkyar
Timeline for d4x0vc_: