Lineage for d1pau.1 (1pau A:,B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21684Fold c.17: Caspase-like [52128] (1 superfamily)
  4. 21685Superfamily c.17.1: Caspase-like [52129] (2 families) (S)
  5. 21686Family c.17.1.1: Caspase [52130] (3 proteins)
  6. 21687Protein Apopain (cpp32) [52131] (1 species)
  7. 21688Species Human (Homo sapiens) [TaxId:9606] [52132] (3 PDB entries)
  8. 21691Domain d1pau.1: 1pau A:,B: [30994]

Details for d1pau.1

PDB Entry: 1pau (more details), 2.5 Å

PDB Description: crystal structure of the complex of apopain with the tetrapeptide aldehyde inhibitor ac-devd-cho

SCOP Domain Sequences for d1pau.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1pau.1 c.17.1.1 (A:,B:) Apopain (cpp32) {Human (Homo sapiens)}
dnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndltr
eeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsltg
kpklfiiqacrgteldcgieXkipveadflyaystapgyyswrnskdgswfiqslcamlk
qyadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltkelyfy

SCOP Domain Coordinates for d1pau.1:

Click to download the PDB-style file with coordinates for d1pau.1.
(The format of our PDB-style files is described here.)

Timeline for d1pau.1: