Lineage for d1cp3a_ (1cp3 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120084Fold c.17: Caspase-like [52128] (1 superfamily)
  4. 120085Superfamily c.17.1: Caspase-like [52129] (2 families) (S)
  5. 120086Family c.17.1.1: Caspase catalytic domain [52130] (5 proteins)
  6. 120087Protein Apopain (caspase-3, cpp32) [52131] (1 species)
  7. 120088Species Human (Homo sapiens) [TaxId:9606] [52132] (4 PDB entries)
  8. 120089Domain d1cp3a_: 1cp3 A: [30992]

Details for d1cp3a_

PDB Entry: 1cp3 (more details), 2.3 Å

PDB Description: crystal structure of the complex of apopain with the tetrapeptide inhibitor ace-dvad-fmc

SCOP Domain Sequences for d1cp3a_:

Sequence, based on SEQRES records: (download)

>d1cp3a_ c.17.1.1 (A:) Apopain (caspase-3, cpp32) {Human (Homo sapiens)}
nsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndltre
eivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsltgk
pklfiiqacrgteldcgietdsgvdddmachkipvdadflyaystapgyyswrnskdgsw
fiqslcamlkqyadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltkely
fyh

Sequence, based on observed residues (ATOM records): (download)

>d1cp3a_ c.17.1.1 (A:) Apopain (caspase-3, cpp32) {Human (Homo sapiens)}
nsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndltre
eivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsltgk
pklfiiqacrgteldcgiehkipvdadflyaystapgyyswrnskdgswfiqslcamlkq
yadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltkelyfyh

SCOP Domain Coordinates for d1cp3a_:

Click to download the PDB-style file with coordinates for d1cp3a_.
(The format of our PDB-style files is described here.)

Timeline for d1cp3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cp3b_