Lineage for d4wxpa1 (4wxp A:186-325)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128600Species Hepatitis C virus [TaxId:11103] [311459] (2 PDB entries)
  8. 2128601Domain d4wxpa1: 4wxp A:186-325 [309919]
    Other proteins in same PDB: d4wxpa2
    automated match to d3rvba1
    complexed with 3vy, cl, na

Details for d4wxpa1

PDB Entry: 4wxp (more details), 2.08 Å

PDB Description: x-ray crystal structure of ns3 helicase from hcv with a bound fragment inhibitor at 2.08 a resolution
PDB Compounds: (A:) NS3-4 protease

SCOPe Domain Sequences for d4wxpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wxpa1 c.37.1.0 (A:186-325) automated matches {Hepatitis C virus [TaxId: 11103]}
dnssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgvymska
hgidpnirtgvraittggpitystygkfladggcsggaydiiicdechstdstsilgigt
vldqaetagarlvvlatatp

SCOPe Domain Coordinates for d4wxpa1:

Click to download the PDB-style file with coordinates for d4wxpa1.
(The format of our PDB-style files is described here.)

Timeline for d4wxpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wxpa2