Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Hepatitis C virus [TaxId:11103] [311459] (2 PDB entries) |
Domain d4wxpa1: 4wxp A:186-325 [309919] Other proteins in same PDB: d4wxpa2 automated match to d3rvba1 complexed with 3vy, cl, na |
PDB Entry: 4wxp (more details), 2.08 Å
SCOPe Domain Sequences for d4wxpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wxpa1 c.37.1.0 (A:186-325) automated matches {Hepatitis C virus [TaxId: 11103]} dnssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgvymska hgidpnirtgvraittggpitystygkfladggcsggaydiiicdechstdstsilgigt vldqaetagarlvvlatatp
Timeline for d4wxpa1: