Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein automated matches [226882] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225057] (9 PDB entries) |
Domain d4wlua2: 4wlu A:169-337 [309890] Other proteins in same PDB: d4wlua1, d4wlub1, d4wluc1, d4wlud1 automated match to d2dfda2 complexed with lmr, nad |
PDB Entry: 4wlu (more details), 2.14 Å
SCOPe Domain Sequences for d4wlua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wlua2 d.162.1.1 (A:169-337) automated matches {Human (Homo sapiens) [TaxId: 9606]} vttldivrantfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltg riqeagtevvkakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyf stplllgkkgieknlgigkvssfeekmisdaipelkasikkgedfvktl
Timeline for d4wlua2: