Lineage for d4wloc2 (4wlo C:169-337)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2557171Protein automated matches [226882] (9 species)
    not a true protein
  7. 2557198Species Human (Homo sapiens) [TaxId:9606] [225057] (8 PDB entries)
  8. 2557229Domain d4wloc2: 4wlo C:169-337 [309886]
    Other proteins in same PDB: d4wloa1, d4wlob1, d4wloc1, d4wlod1
    automated match to d2dfda2
    complexed with nai, oaa

Details for d4wloc2

PDB Entry: 4wlo (more details), 2.5 Å

PDB Description: crystal structure of oxaloacetate and nadh bound mdh2
PDB Compounds: (C:) Malate dehydrogenase, mitochondrial

SCOPe Domain Sequences for d4wloc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wloc2 d.162.1.1 (C:169-337) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vttldivrantfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltg
riqeagtevvkakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyf
stplllgkkgieknlgigkvssfeekmisdaipelkasikkgedfvktl

SCOPe Domain Coordinates for d4wloc2:

Click to download the PDB-style file with coordinates for d4wloc2.
(The format of our PDB-style files is described here.)

Timeline for d4wloc2: