Lineage for d4wlnd1 (4wln D:24-168)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2105555Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2105961Protein automated matches [226881] (5 species)
    not a true protein
  7. 2105979Species Human (Homo sapiens) [TaxId:9606] [225056] (7 PDB entries)
  8. 2105999Domain d4wlnd1: 4wln D:24-168 [309879]
    Other proteins in same PDB: d4wlna2, d4wlnb2, d4wlnc2, d4wlnd2
    automated match to d2dfda1
    complexed with po4

Details for d4wlnd1

PDB Entry: 4wln (more details), 2.28 Å

PDB Description: crystal structure of apo mdh2
PDB Compounds: (D:) Malate dehydrogenase, mitochondrial

SCOPe Domain Sequences for d4wlnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wlnd1 c.2.1.5 (D:24-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
vnstipitaevfkkhgvynpnkifg

SCOPe Domain Coordinates for d4wlnd1:

Click to download the PDB-style file with coordinates for d4wlnd1.
(The format of our PDB-style files is described here.)

Timeline for d4wlnd1: