Lineage for d4wlnb2 (4wln B:169-337)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2999256Protein automated matches [226882] (10 species)
    not a true protein
  7. 2999283Species Human (Homo sapiens) [TaxId:9606] [225057] (9 PDB entries)
  8. 2999305Domain d4wlnb2: 4wln B:169-337 [309876]
    Other proteins in same PDB: d4wlna1, d4wlnb1, d4wlnc1, d4wlnd1
    automated match to d2dfda2
    complexed with po4

Details for d4wlnb2

PDB Entry: 4wln (more details), 2.28 Å

PDB Description: crystal structure of apo mdh2
PDB Compounds: (B:) Malate dehydrogenase, mitochondrial

SCOPe Domain Sequences for d4wlnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wlnb2 d.162.1.1 (B:169-337) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vttldivrantfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltg
riqeagtevvkakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyf
stplllgkkgieknlgigkvssfeekmisdaipelkasikkgedfvktl

SCOPe Domain Coordinates for d4wlnb2:

Click to download the PDB-style file with coordinates for d4wlnb2.
(The format of our PDB-style files is described here.)

Timeline for d4wlnb2: