Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein automated matches [226881] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225056] (8 PDB entries) |
Domain d4wlfb1: 4wlf B:24-168 [309867] Other proteins in same PDB: d4wlfa2, d4wlfb2, d4wlfc2, d4wlfd2 automated match to d2dfda1 complexed with lmr, po4 |
PDB Entry: 4wlf (more details), 2.2 Å
SCOPe Domain Sequences for d4wlfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wlfb1 c.2.1.5 (B:24-168) automated matches {Human (Homo sapiens) [TaxId: 9606]} nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp vnstipitaevfkkhgvynpnkifg
Timeline for d4wlfb1: