SCOPe 2.06: Domain d4wa6f_: 4wa6 F:

Lineage for d4wa6f_ (4wa6 F:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.301: Sus1-like [310571] (1 superfamily)
   5 helices; articulated hairpin fold

4. Superfamily a.301.1: Sus1-like [310603] (1 family)
   Pfam PF10163
   interactions with Sac3, Cdc31 described in PubMed 19328066

5. Family a.301.1.1: Sus1-like [310653] (3 proteins)

6. Protein Sus1 [310814] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311080] (13 PDB entries)

8. Domain d4wa6f_: 4wa6 F: [309820]
   automated match to d3fwbc_
   complexed with zn; mutant

Details for d4wa6f_

PDB Entry: 4wa6, 2.36 Å

PDB Description: structure of yeast saga dubm with sgf73 n59d mutant at 2.36 angstroms resolution

PDB Compounds: (F:) Transcription and mRNA export factor SUS1

SCOPe Domain Sequences for d4wa6f_:

Sequence; same for both SEQRES and ATOM records:

>d4wa6f_ a.301.1.1 (F:) Sus1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdtaqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftqil
stvepkalemvsdstretvlkqirefleeivdt

Timeline for d4wa6f_:

• d4wa6f_ is new in SCOPe 2.06-stable
  
• d4wa6f_ appears in SCOPe 2.07
  
• d4wa6f_ appears in the current release, SCOPe 2.08