SCOPe 2.06: Domain d4wa2b1: 4wa2 B:8-324

Lineage for d4wa2b1 (4wa2 B:8-324)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (9 species)
   includes rudiment esterase domain

7. Species Influenza a virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId:1136533] [311449] (2 PDB entries)

8. Domain d4wa2b1: 4wa2 B:8-324 [309806]
   Other proteins in same PDB: d4wa2a2, d4wa2b2, d4wa2c2, d4wa2d2, d4wa2e2, d4wa2f2
   automated match to d1ha0a1
   complexed with nag

Details for d4wa2b1

PDB Entry: 4wa2, 2.5 Å

PDB Description: the crystal structure of hemagglutinin from a h3n8 influenza virus isolated from new england harbor seals in complex with 3'sln

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4wa2b1:

Sequence; same for both SEQRES and ATOM records:

>d4wa2b1 b.19.1.2 (B:8-324) Hemagglutinin {Influenza a virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId: 1136533]}
nntatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgrdcklm
dallgdphcdvfqdetwdlyverssassncypydvpdyaslrslvassgtlefitegftw
tgvtqngesgackrgpangffsrlnwltksgsvypllnvtmpnndnfdklyvwgvhhpst
nqeqtnlyvqasgrvtvstrrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
ngnlvaprgyfkmrtgkssimrsnapidtcisecitpngsipndkpfqnvnkitygacpk
yvkqstlklatgmrnvp

Timeline for d4wa2b1:

• d4wa2b1 is new in SCOPe 2.06-stable
  
• d4wa2b1 appears in SCOPe 2.07
  
• d4wa2b1 appears in the current release, SCOPe 2.08