SCOPe 2.06: Domain d4wa1f2: 4wa1 F:330-503

Lineage for d4wa1f2 (4wa1 F:330-503)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (23 species)
   not a true protein

7. Species Influenza a virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId:1136533] [311450] (2 PDB entries)

8. Domain d4wa1f2: 4wa1 F:330-503 [309803]
   Other proteins in same PDB: d4wa1a1, d4wa1b1, d4wa1c1, d4wa1d1, d4wa1e1, d4wa1f1
   automated match to d1ha0a2
   complexed with nag

Details for d4wa1f2

PDB Entry: 4wa1, 1.9 Å

PDB Description: the crystal structure of hemagglutinin from a h3n8 influenza virus isolated from new england harbor seals

PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d4wa1f2:

Sequence; same for both SEQRES and ATOM records:

>d4wa1f2 h.3.1.0 (F:330-503) automated matches {Influenza a virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId: 1136533]}
glfgaiagfiengwegmidgwygfrhknsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekeflevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfqik

Timeline for d4wa1f2:

• d4wa1f2 is new in SCOPe 2.06-stable
  
• d4wa1f2 appears in SCOPe 2.07
  
• d4wa1f2 appears in the current release, SCOPe 2.08